DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp1cc

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_700468.5 Gene:ppp1cc / 571753 ZFINID:ZDB-GENE-030131-5877 Length:323 Species:Danio rerio


Alignment Length:289 Identity:176/289 - (60%)
Similarity:233/289 - (80%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYD 93
            ||::.::.:|:..|.||. :.:.|.|:|:..||..:||:||.:|:||.:.||:::.||||||:||
Zfish     7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    94 LLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGF 158
            ||::.:..||||::.||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|||
Zfish    72 LLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   159 FDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLL 223
            :|||:|||.:||||||.||:||:|:|||:..:||||||||||.|:.:..|..|.|||:||:.|||
Zfish   137 YDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   224 CDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTV 288
            |||||||||:...||..:|||||:.:|.:|:.|||.|:|.||:|||||||||||||||||||||:
Zfish   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   289 FSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||||.:|||||.|.||:.|:.||.|
Zfish   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 169/265 (64%)
PP2Ac 54..315 CDD:197547 166/260 (64%)
ppp1ccXP_700468.5 PTZ00480 6..313 CDD:185658 176/289 (61%)
MPP_PP1_PPKL 8..298 CDD:277359 175/288 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.