DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp3ccb

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_005155370.1 Gene:ppp3ccb / 565241 ZFINID:ZDB-GENE-070112-1102 Length:511 Species:Danio rerio


Alignment Length:274 Identity:111/274 - (40%)
Similarity:163/274 - (59%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LESEVNL-LCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYV 116
            ||.:|.| :......:...|..:|.|.|||.|.||:||||:||:|:.:..|.|..||||||||||
Zfish    53 LEEDVALRIINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYV 117

  Fly   117 DRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCM 181
            |||..|:|.:..|.||::..|..::|||||||.:.:...:.|..|||.:||.:::...::.::|:
Zfish   118 DRGYFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCL 182

  Fly   182 PVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDP-DRYGFGWTS----- 240
            |:||:::.:..|.||||||::..|.:|..:.|..|.|..|.:|||||||| :.||...||     
Zfish   183 PLAALLNQQFLCVHGGLSPEVTCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEKTSEHFCH 247

  Fly   241 -SDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ------LVTVFSAPNYCGLY 298
             |.||.||.|....:..||..|:...|.|||:..:.||..:.|.|      |:|:||||||..:|
Zfish   248 NSVRGCSYFYSYPAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVY 312

  Fly   299 DNAGASMGVDKDLV 312
            :|..|.:..:.:::
Zfish   313 NNKAAVLKYENNVM 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 111/274 (41%)
PP2Ac 54..315 CDD:197547 110/273 (40%)
ppp3ccbXP_005155370.1 MPP_PP2B 38..342 CDD:277361 111/274 (41%)
PP2Ac 55..326 CDD:197547 109/270 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.