DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp4c

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:310 Identity:138/310 - (44%)
Similarity:199/310 - (64%) Gaps:15/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLK 96
            ::||..::...||.::    :.||||..||..|||:.::|..:..|.:|:.|.||||||||||.:
Mouse     4 ISDLDRQIEQLRRCEL----IKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKE 64

  Fly    97 ILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDE 161
            :....|..|:|.|||:||:||||..||||..|||||:|::|..|.|:||||||:.:.:||||:||
Mouse    65 LFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDE 129

  Fly   162 CKRRY-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCD 225
            |.|:| :|.:|:...:.::.:.::|||..:|||.||||||.::.|..|.:|.|..|||..|.:||
Mouse   130 CLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCD 194

  Fly   226 LLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFS 290
            ||||||:. ..||..|.||..||:|.||:.:|...||.|::|||||:|.:||::.....::||:|
Mouse   195 LLWSDPED-TTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWS 258

  Fly   291 APNYCGLYDNAGASMGVD----KDLVISFDIQRGDIRRIVVRNESVSPIS 336
            |||||....|..|.:.:|    ||.:| |:....:.|.|    .|..|::
Mouse   259 APNYCYRCGNVAAILELDEHLQKDFII-FEAAPQETRGI----PSKKPVA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 130/270 (48%)
PP2Ac 54..315 CDD:197547 129/265 (49%)
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 134/289 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.