DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPP6C

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:276 Identity:124/276 - (44%)
Similarity:170/276 - (61%) Gaps:7/276 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVE 124
            ||....:|.|:|..:..|..|:.|.||||||||||.::....|..|.|.|:|:||:||||..|:|
Human    64 LCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLE 128

  Fly   125 TITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKTFVDCYNCMPVAAIIS 188
            |.|.||||:.|:|..|.||||||||:.:.:||||:|||:.:| ....|:.....::.:.|||:|.
Human   129 TFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALID 193

  Fly   189 HRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDV 253
            .:|.|.||||||.:|.|..|.:|.|..|:|..|..|||:||||:... .|..|.||..:|:|..|
Human   194 EQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVD-TWAISPRGAGWLFGAKV 257

  Fly   254 LEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDIQ 318
            ..:|:..|:..|:|||||:|.:||:|....:||||:||||||....|. ||:.|.||:    :.:
Human   258 TNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNI-ASIMVFKDV----NTR 317

  Fly   319 RGDIRRIVVRNESVSP 334
            ...:.|.|..:|.|.|
Human   318 EPKLFRAVPDSERVIP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 119/257 (46%)
PP2Ac 54..315 CDD:197547 119/255 (47%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 120/267 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.