DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPP5C

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_016882424.1 Gene:PPP5C / 5536 HGNCID:9322 Length:551 Species:Homo sapiens


Alignment Length:283 Identity:111/283 - (39%)
Similarity:161/283 - (56%) Gaps:20/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQT 107
            |:...|.|..::..::.|.||. |..|.|      ...|.|.||.||||||||.|.:..|.|.:|
Human   206 RKCAYQILVQVKEVLSKLSTLV-ETTLKE------TEKITVCGDTHGQFYDLLNIFELNGLPSET 263

  Fly   108 R-YLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLW 171
            . |:|.||:||||..|||.|..|...::.:|.|.:|||||||:.::|::|||..|.|.:||.:::
Human   264 NPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMY 328

  Fly   172 KTFVDCYNCMPVAAIISHRIFCCHGGL-SPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYG 235
            :.|.:.:..:|:|..|:.::...|||| |.....|.:|..|.|..:.|::|.:||||||||....
Human   329 ELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQN 393

  Fly   236 FGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDN 300
             |.:.|.||||..:|.||.:.||::|:.|.:.|:|:|..:|||.....:.||||||||||....|
Human   394 -GRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGN 457

  Fly   301 AGASMGVDKDLVISFDIQRGDIR 323
            ..:.:          .:|..|:|
Human   458 KASYI----------HLQGSDLR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 105/267 (39%)
PP2Ac 54..315 CDD:197547 105/262 (40%)
PPP5CXP_016882424.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.