DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPP2CA

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_002706.1 Gene:PPP2CA / 5515 HGNCID:9299 Length:309 Species:Homo sapiens


Alignment Length:265 Identity:129/265 - (48%)
Similarity:174/265 - (65%) Gaps:2/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYV 116
            |.||:|..||..|:|:...|..:..|..|:.|.||:||||:||:::....|..|.|.|||:||||
Human    23 LSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYV 87

  Fly   117 DRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKTFVDCYNC 180
            |||..||||:|||:||:|::.:.|.:|||||||:.:.:||||:|||.|:| ...:||.|.|.::.
Human    88 DRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDY 152

  Fly   181 MPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGV 245
            :|:.|::..:|||.||||||.:..|.:|.::.|..|||..|.:|||||||||..| ||..|.||.
Human   153 LPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRG-GWGISPRGA 216

  Fly   246 SYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKD 310
            .|.:|:|:.|.|...|...||.||||:|.:||.:...|.:||:|||||||....|..|.|.:|..
Human   217 GYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDT 281

  Fly   311 LVISF 315
            |..||
Human   282 LKYSF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 129/265 (49%)
PP2Ac 54..315 CDD:197547 126/261 (48%)
PPP2CANP_002706.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 129/265 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.