DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPP1CC

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens


Alignment Length:289 Identity:176/289 - (60%)
Similarity:233/289 - (80%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYD 93
            ||::.::.:|:..|.||. :.:.|.|:|:..||..:||:||.:|:||.:.||:::.||||||:||
Human     7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    94 LLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGF 158
            ||::.:..|:||::.||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|||
Human    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   159 FDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLL 223
            :|||||||.:||||||.||:||:|:|||:..:||||||||||.|:.:..|..|.|||:||:.|||
Human   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   224 CDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTV 288
            |||||||||:...||..:|||||:.:|.:|:.|||.|:|.||:|||||||||||||||||||||:
Human   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   289 FSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||||.:|||||.|.||:.|:.||.|
Human   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 169/265 (64%)
PP2Ac 54..315 CDD:197547 166/260 (64%)
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 176/289 (61%)
MPP_PP1_PPKL 8..298 CDD:277359 175/288 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.