DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPP1CB

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_002700.1 Gene:PPP1CB / 5500 HGNCID:9282 Length:327 Species:Homo sapiens


Alignment Length:291 Identity:174/291 - (59%)
Similarity:231/291 - (79%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GALNLNDLLNKLMSFRRSKMQRL-PLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQF 91
            |.||::.|:.:|:..|..:..:: .:.|:||..||..:||:||.:|:||.:.||:::.||||||:
Human     4 GELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQY 68

  Fly    92 YDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVY 156
            .|||::.:..|:||:..||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|
Human    69 TDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 133

  Fly   157 GFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETG 221
            ||:||||||:.:||||||.||:||:|:|||:..:||||||||||.|:.:..|..|.|||:||:||
Human   134 GFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTG 198

  Fly   222 LLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLV 286
            |||||||||||:...||..:|||||:.:|.||:.|||.::|.||:||||||||||||||||||||
Human   199 LLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLV 263

  Fly   287 TVFSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            |:||||||||.:||||..|.||:.|:.||.|
Human   264 TLFSAPNYCGEFDNAGGMMSVDETLMCSFQI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 167/265 (63%)
PP2Ac 54..315 CDD:197547 165/260 (63%)
PPP1CBNP_002700.1 MPP_PP1_PPKL 7..297 CDD:277359 172/288 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158260
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.660

Return to query results.
Submit another query.