DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPP1CA

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens


Alignment Length:315 Identity:179/315 - (56%)
Similarity:238/315 - (75%) Gaps:21/315 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSNSEANADYRLPGALNLNDLLNKLMSFRR------SKMQ------RLPLLESEVNLLCTLAREL 67
            :|:||         .|||:.::.:|:...|      :.:|      .:.|.|:|:..||..:||:
Human     1 MSDSE---------KLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREI 56

  Fly    68 FLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLAL 132
            ||.:|:||.:.||:::.||||||:||||::.:..|:||::.||||||||||||.|:|||.||||.
Human    57 FLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAY 121

  Fly   133 RVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGG 197
            ::|:|::.:|||||||..|:||:|||:|||||||.:||||||.||:||:|:|||:..:|||||||
Human   122 KIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGG 186

  Fly   198 LSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKND 262
            |||.|:.:..|..|.|||:||:.||||||||||||:...||..:|||||:.:|.:|:.|||.|:|
Human   187 LSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD 251

  Fly   263 FDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            .||:|||||||||||||||||||||:||||||||.:|||||.|.||:.|:.||.|
Human   252 LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 169/265 (64%)
PP2Ac 54..315 CDD:197547 166/260 (64%)
PPP1CANP_001008709.1 PTZ00480 6..319 CDD:185658 176/301 (58%)
MPP_PP1_PPKL 8..309 CDD:277359 175/299 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.