DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp1cb

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001011467.1 Gene:ppp1cb / 496958 XenbaseID:XB-GENE-961670 Length:327 Species:Xenopus tropicalis


Alignment Length:291 Identity:174/291 - (59%)
Similarity:232/291 - (79%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GALNLNDLLNKLMSFRRSKMQRL-PLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQF 91
            |.||::.|:::|:..|..:..:: .:.|:||..||..:||:||.:|:||.:.||:::.||||||:
 Frog     4 GELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQY 68

  Fly    92 YDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVY 156
            .|||::.:..|:||:..||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|
 Frog    69 TDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 133

  Fly   157 GFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETG 221
            ||:||||||:.:||||||.||:||:|:|||:..:||||||||||.|:.:..|..|.|||:||:||
 Frog   134 GFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTG 198

  Fly   222 LLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLV 286
            |||||||||||:...||..:|||||:.:|.||:.|||.::|.||:||||||||||||||||||||
 Frog   199 LLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLV 263

  Fly   287 TVFSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            |:||||||||.:||||..|.||:.|:.||.|
 Frog   264 TLFSAPNYCGEFDNAGGMMSVDETLMCSFQI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 167/265 (63%)
PP2Ac 54..315 CDD:197547 165/260 (63%)
ppp1cbNP_001011467.1 MPP_PP1_PPKL 7..297 CDD:277359 172/288 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.