DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Pp1-87B

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster


Alignment Length:289 Identity:173/289 - (59%)
Similarity:232/289 - (80%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYD 93
            :|::.::::|:..|.::. :.:.|.|.|:..||..:||:||.:|:||.:.||:::.||||||:||
  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69

  Fly    94 LLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGF 158
            ||::.:..|:||::.||||||||||||.|:|||.||||.::|:.::.:|||||||..|:||:|||
  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134

  Fly   159 FDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLL 223
            :|||||||::||||||.||:||:|||||:..:||||||||||.|..:..|..|.|||:||:.|||
  Fly   135 YDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199

  Fly   224 CDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTV 288
            |||||||||:...||..:|||||:.:|.:|:.|||||::|||:|||||||||||||||||.|||:
  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264

  Fly   289 FSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||||.:|||||.|.||..|:.||.|
  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 169/265 (64%)
PP2Ac 54..315 CDD:197547 166/260 (64%)
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 173/288 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438837
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.