DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PpY-55A

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster


Alignment Length:283 Identity:155/283 - (54%)
Similarity:204/283 - (72%) Gaps:3/283 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILD 99
            ::.:|.|...|:   ..|.|..:..|....||:...:||||.:.||:.:.|||||||.|||:|..
  Fly    12 IIKELTSLNGSE---CTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFK 73

  Fly   100 QCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKR 164
            .||:||:..||||||||||||.|:|||.||.|.:||:|.:.:||||||||.|:|::|||:||.||
  Fly    74 ACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKR 138

  Fly   165 RYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWS 229
            |:||:||.:|.||:|.:||||::..|||||||||||.|:.|..|..|.|||::|:.|::|||||:
  Fly   139 RHTVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWA 203

  Fly   230 DPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNY 294
            |.:....||..:|||||:.:.:.::..||:..|..|:.|||:||||||||||.||||||||||||
  Fly   204 DLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNY 268

  Fly   295 CGLYDNAGASMGVDKDLVISFDI 317
            ||:.:|||..|.|..||:.||.|
  Fly   269 CGMMNNAGGVMSVSTDLICSFVI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 151/265 (57%)
PP2Ac 54..315 CDD:197547 148/260 (57%)
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 155/283 (55%)
MPP_PP1_PPKL 8..294 CDD:277359 155/283 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.