DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Pp4-19C

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:297 Identity:130/297 - (43%)
Similarity:191/297 - (64%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ADYRLPGALNLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGD 86
            :||        :||..::...:|.::    :.|:||..||..|||:.::|..:..|.:|:.|.||
  Fly     2 SDY--------SDLDRQIEQLKRCEI----IKENEVKALCAKAREILVEEGNVQRVDSPVTVCGD 54

  Fly    87 IHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQS 151
            ||||||||.::....|..|:..|||:||:||||..||||..|||||:|::|..|.|:||||||:.
  Fly    55 IHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQ 119

  Fly   152 VNRVYGFFDECKRRY-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPT 215
            :.:||||:|||.|:| :..:|:...:.::.:.::|||..:|||.||||||.::.|..|.||.|..
  Fly   120 ITQVYGFYDECLRKYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQ 184

  Fly   216 EVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFF 280
            |||..|.:||||||||:.. .||..|.||..||:|.||:.:|.:.||.|::|||||:|.:|:::.
  Fly   185 EVPHDGPMCDLLWSDPEDQ-TGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWH 248

  Fly   281 AKRQLVTVFSAPNYCGLYDNAGASMGVD----KDLVI 313
            ....::||:||||||....|..|.:.::    :|.||
  Fly   249 FNETVLTVWSAPNYCYRCGNVAAILELNEYLHRDFVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 125/268 (47%)
PP2Ac 54..315 CDD:197547 125/265 (47%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 128/285 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.