DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp1ccb

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001357876.1 Gene:Ppp1ccb / 434233 MGIID:3647492 Length:337 Species:Mus musculus


Alignment Length:289 Identity:176/289 - (60%)
Similarity:233/289 - (80%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYD 93
            ||::.::.:|:..|.||. :.:.|.|:|:..||..:||:||.:|:||.:.||:::.||||||:||
Mouse     7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    94 LLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGF 158
            ||::.:..|:||::.||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|||
Mouse    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   159 FDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLL 223
            :|||||||.:||||||.||:||:|:|||:..:||||||||||.|:.:..|..|.|||:||:.|||
Mouse   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   224 CDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTV 288
            |||||||||:...||..:|||||:.:|.:|:.|||.|:|.||:|||||||||||||||||||||:
Mouse   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   289 FSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||||.:|||||.|.||:.|:.||.|
Mouse   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 169/265 (64%)
PP2Ac 54..315 CDD:197547 166/260 (64%)
Ppp1ccbNP_001357876.1 MPP_PP1_PPKL 8..298 CDD:277359 175/288 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.