DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and rdgC

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:321 Identity:104/321 - (32%)
Similarity:161/321 - (50%) Gaps:34/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NADYRLPGALNLNDLLNKLMSFRRSKMQRLP-------LLESEVNLLCTLARELFLDEPMLLNVP 78
            ||...||...|..|||  :..||:.:..||.       |.|:..:|     ::|....|:...|.
  Fly   178 NAKIELPIRKNHIDLL--IDVFRKKRGNRLHPKYVALILREAAKSL-----KQLPNISPVSTAVS 235

  Fly    79 APIRVVGDIHGQFYDLLKILDQCGYPPQTR-YLFLGDYVDRGKNSVETITLLLALRVKFPKHIYL 142
            ..:.|.||:||:..|||.:|.:.|.|..:. |:|.||:|||||..:|.:.|||:|.:.||..::|
  Fly   236 QQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFL 300

  Fly   143 LRGNHESQSVNRVYGFFDECKRRY--TVKLWKTFVD-CYNCMPVAAIISHRIFCCHGGLSPQLKE 204
            .|||||...:|..|||..|.:.:|  ..|....|:| .|..:|:.::::.|:...|||.|.. ..
  Fly   301 NRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDS-TS 364

  Fly   205 LSNIESIAR---------------PTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVL 254
            |..|:||.|               |.:..|...:.|::||||........::.||....:|.||.
  Fly   365 LDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVT 429

  Fly   255 EKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISF 315
            :.|||::....|.|:|:...:|:||....:::|:|||.||..:..|.||.:.::..|:..|
  Fly   430 DNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHF 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 92/291 (32%)
PP2Ac 54..315 CDD:197547 90/279 (32%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 101/315 (32%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.