DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp2cab

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_957205.2 Gene:ppp2cab / 393885 ZFINID:ZDB-GENE-040426-877 Length:309 Species:Danio rerio


Alignment Length:265 Identity:126/265 - (47%)
Similarity:174/265 - (65%) Gaps:2/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYV 116
            |.|::|..||..|:|:...|..:..|..|:.|.||:||||:||:::....|..|.|.|||:||||
Zfish    23 LSETQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYV 87

  Fly   117 DRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKTFVDCYNC 180
            |||..||||::||:||:|::.:.:.:|||||||:.:.:||||:|||.|:| ...:||.|.|.::.
Zfish    88 DRGYYSVETVSLLVALKVRYRERVTILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDY 152

  Fly   181 MPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGV 245
            :|:.|::..:|||.||||||.:..|.:|.::.|..|||..|.:|||||||||..| ||..|.||.
Zfish   153 LPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRG-GWGISPRGA 216

  Fly   246 SYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKD 310
            .|.:|:|:.|.|...|...||.||||:|.:||.:...|.:||:|||||||....|..|.|.:|..
Zfish   217 GYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDT 281

  Fly   311 LVISF 315
            |..||
Zfish   282 LKYSF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 126/265 (48%)
PP2Ac 54..315 CDD:197547 123/261 (47%)
ppp2cabNP_957205.2 MPP_PP2A_PP4_PP6 9..293 CDD:277360 126/265 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.