DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and CG11597

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:297 Identity:134/297 - (45%)
Similarity:184/297 - (61%) Gaps:11/297 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PGALNLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQF 91
            |.|:|..|   :|:...|....||| .|.||..||....:|.:.|..||::.:|..|.|||||||
  Fly     7 PEAMNDAD---RLVENLRHVPVRLP-RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQF 67

  Fly    92 YDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVY 156
            .|||.:|:..|...:.|||||||.||||||||||..||.||:|:.|..:.|||||||.:|..|.|
  Fly    68 EDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSY 132

  Fly   157 GFFDECKRRY-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPET 220
            ||::||..|| :..:|:.....::.:|:||||...|.|.||||||.::.|.::.|:.|..|:||:
  Fly   133 GFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPES 197

  Fly   221 GLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQL 285
            |::.|||||||.. ..||.:|.||...|:|.||:|:|.:.|...|:|||||:.:||:.:...:.|
  Fly   198 GIIADLLWSDPQE-APGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLL 261

  Fly   286 VTVFSAPNYCGLYDNAGASMGV----DKDLVISFDIQ 318
            ||::||||||....|..|.:.:    |.|..: |:.|
  Fly   262 VTIWSAPNYCYRCGNKAAILRLNAAGDYDFKV-FEAQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 125/270 (46%)
PP2Ac 54..315 CDD:197547 123/265 (46%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 131/292 (45%)
MPP_superfamily 12..296 CDD:301300 130/289 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.