DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PpN58A

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:325 Identity:177/325 - (54%)
Similarity:231/325 - (71%) Gaps:10/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSN-SEANADYRLPGALNLNDLLNKLMSFRR--SKMQRLPLLESEVNLLCTLARELFLDEPMLLN 76
            ||| |..|...:....:||:.::.||.....  |.:|   :...|:..:|:.|||:.|.:|.||.
  Fly     6 LSNGSNKNKTLKFDEGINLDQIIAKLKLIGEIGSVVQ---ISVREIEAVCSRAREVLLKQPTLLE 67

  Fly    77 VPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIY 141
            :||||.::||||||:.:||:..:..||||.:.||.|||||||||.|:||:||||||:.::|...|
  Fly    68 IPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFY 132

  Fly   142 LLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELS 206
            |||||||..|:|..|||:||||||||||||:||||||||:|:||||...||||||||||.|..:.
  Fly   133 LLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQ 197

  Fly   207 NIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQ 271
            .|..|.||.|:||:||:||:||||||....||..::||||:.:|.||:..||.:...:|:||.||
  Fly   198 QIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQ 262

  Fly   272 VVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDIQRGDIRRIVVRNESVSPIS 336
            ||||||||||||||:|:||||||||.:|||||.|.:::||:.:|.:|    |.|:.....:|.||
  Fly   263 VVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQ----RPILSEQRRLSDIS 323

  Fly   337  336
              Fly   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 160/265 (60%)
PP2Ac 54..315 CDD:197547 159/260 (61%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 167/295 (57%)
MPP_superfamily 23..311 CDD:301300 167/294 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.