DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Pp2B-14D

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster


Alignment Length:259 Identity:104/259 - (40%)
Similarity:161/259 - (62%) Gaps:13/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLA 131
            |...|..::::.||:.|.||||||||||:|:.:..|.|..|:|||||||||||..|:|.:..|.:
  Fly   137 LLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWS 201

  Fly   132 LRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHG 196
            |::.:|:.::|||||||.:.:...:.|..|||.:|:.:::...:|.::|:|:||:::.:..|.||
  Fly   202 LKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHG 266

  Fly   197 GLSPQLKELSNIESIARPTEVPETGLLCDLLWSDP-DRYG------FGWTSSDRGVSYLYGRDVL 254
            ||||::.||.:|..:.|..|.|..|.:|||||||| :.:|      |...:|.||.||.|.....
  Fly   267 GLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAAC 331

  Fly   255 EKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ------LVTVFSAPNYCGLYDNAGASMGVDKDLV 312
            ..|||.|:...:.|||:..:.||..:.|.|      |:|:||||||..:|:|..|.:..:.:::
  Fly   332 CDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 104/259 (40%)
PP2Ac 54..315 CDD:197547 104/259 (40%)
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 104/259 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.