DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppef1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:334 Identity:102/334 - (30%)
Similarity:158/334 - (47%) Gaps:65/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GALNLNDLLNKLMSFRRSKMQRLPLLESEVNLLC-------TL-----------ARELFLDEPML 74
            |.:::.|      |:...::| .||..:::|||.       ||           ||::....|..
  Rat   124 GLIDVPD------SYDGPRLQ-FPLTFTDINLLLQAFKQQQTLHAHYVLEVLFEARKILKQMPNF 181

  Fly    75 LNV---PA-PIRVVGDIHGQFYDLLKILDQCGYPPQTR-YLFLGDYVDRGKNSVETITLLLALRV 134
            ..:   || .|.:.||:||:..||:.|..:.|.|.:.. |:|.||:||||.||:|.:.:||...:
  Rat   182 TRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFL 246

  Fly   135 KFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTV---KLWKTFVDCYNCMPVAAIISHRIFCCHG 196
            .:|..::|.|||||...:|..|||..|..::|.:   |:.:...:.|..:|:..||.:.|...||
  Rat   247 VYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGKKILQVLEELYTWLPIGTIIDNEILVIHG 311

  Fly   197 GLSPQ-----LKEL--SNIESI-----------------ARPTEVP--------ETGLLCDLLWS 229
            |:|..     |::|  :.::|:                 |.|:|..        |...:.|||||
  Rat   312 GISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWS 376

  Fly   230 DPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNY 294
            ||......:.::.||....:|.||..|.|.||...:|.|:|:...||||.....:::|||||.||
  Rat   377 DPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGKVITVFSASNY 441

  Fly   295 CGLYDNAGA 303
            .....|.||
  Rat   442 YEEGSNRGA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 98/311 (32%)
PP2Ac 54..315 CDD:197547 96/308 (31%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 98/311 (32%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.