DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and sds21

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001342764.1 Gene:sds21 / 2539179 PomBaseID:SPCC31H12.05c Length:322 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:177/311 - (56%)
Similarity:236/311 - (75%) Gaps:7/311 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DYRLPGALNLNDLLNKLMSFRRSK-MQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGD 86
            ||      :::.::.||:..|..| .:::.|.::|:..|||.:|.:||.:||||.:.||:::.||
pombe     2 DY------DIDAIIEKLVKARNGKPSKQVQLSDAEIRYLCTTSRSIFLSQPMLLELEAPLKICGD 60

  Fly    87 IHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQS 151
            ||||:.|||::.:..||||...||||||||||||.|:|.|.||.|.::|:|::.:|||||||..|
pombe    61 IHGQYSDLLRLFEYGGYPPDANYLFLGDYVDRGKQSLEVICLLFAYKIKYPENFFLLRGNHEFAS 125

  Fly   152 VNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTE 216
            :||:|||:|||||||::||||||.||:|||||||:|..:|||.||||||.|..|..|:.|.|||:
pombe   126 INRIYGFYDECKRRYSIKLWKTFTDCFNCMPVAAVIDEKIFCMHGGLSPDLNSLDQIQRIIRPTD 190

  Fly   217 VPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFA 281
            :|:|||||||:||||::...||..:||||||.:|.||:.:||||:|.||:||||||||||||||.
pombe   191 IPDTGLLCDLVWSDPEKDLTGWGENDRGVSYTFGADVVSRFLQKHDLDLICRAHQVVEDGYEFFG 255

  Fly   282 KRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDIQRGDIRRIVVRNESV 332
            ||||||:||||||||.:||.||.|.|::||:.||.|.:...:|..|...|:
pombe   256 KRQLVTIFSAPNYCGEFDNVGAMMSVNEDLLCSFQILKPAEKRQRVSQSSI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 167/265 (63%)
PP2Ac 54..315 CDD:197547 164/260 (63%)
sds21NP_001342764.1 MPP_PP1_PPKL 4..294 CDD:277359 172/289 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.