DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp1ca

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:304 Identity:178/304 - (58%)
Similarity:238/304 - (78%) Gaps:10/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSNSEANADYRLPGALNLNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVP 78
            :|:||         .|||:.::.:|:..:.|:. :.:.|.|:|:..||..:||:||.:|:||.:.
  Rat     1 MSDSE---------KLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELE 56

  Fly    79 APIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLL 143
            ||:::.||||||:||||::.:..|:||::.||||||||||||.|:|||.||||.::|:|::.:||
  Rat    57 APLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL 121

  Fly   144 RGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNI 208
            |||||..|:||:|||:|||||||.:||||||.||:||:|:|||:..:||||||||||.|:.:..|
  Rat   122 RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQI 186

  Fly   209 ESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVV 273
            ..|.|||:||:.||||||||||||:...||..:|||||:.:|.:|:.|||.|:|.||:|||||||
  Rat   187 RRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVV 251

  Fly   274 EDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||||||||||:||||||||.:|||||.|.||:.|:.||.|
  Rat   252 EDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 169/265 (64%)
PP2Ac 54..315 CDD:197547 166/260 (64%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 174/288 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.