DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppef1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_011246120.1 Gene:Ppef1 / 237178 MGIID:1097157 Length:676 Species:Mus musculus


Alignment Length:344 Identity:98/344 - (28%)
Similarity:157/344 - (45%) Gaps:57/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FAGQLSNSEANADYRLPGALNLNDLLNKLMSFRRSKMQRLPLLESEVNL-LCTLARELFLDEPML 74
            |.|.:...::....||...|...|:...|.:|::.:     :|.:...| :...||::....|..
Mouse   126 FLGLIEVPDSYDGPRLQFPLTFTDIHILLQAFKQQQ-----ILHAHYVLEVLFEARKVLKQMPNF 185

  Fly    75 LNV---PA-PIRVVGDIHGQFYDLLKILDQCGYPPQTR-YLFLGDYVDRGKNSVETITLLLALRV 134
            .:|   || .|.:.||:||:..||:.|..:.|.|.:.. |:|.||:||||.||:|.:.:||...:
Mouse   186 SHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFL 250

  Fly   135 KFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTV---KLWKTFVDCYNCMPVAAIISHRIFCCHG 196
            .:|..::|.|||||...:|..|||..|..::|.:   |:.:...:.|..:|:..||.:.|...||
Mouse   251 VYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHG 315

  Fly   197 GLSPQLKELSNIESIAR-----------------------------------PTEVPETGL---- 222
            |:| :..:|:.:..:.|                                   |.:.|...|    
Mouse   316 GIS-ESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQE 379

  Fly   223 ---LCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ 284
               :.|:|||||......:.::.||....:|.||..|.|.||...::.|:|:...||||.....:
Mouse   380 WEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGK 444

  Fly   285 LVTVFSAPNYCGLYDNAGA 303
            ::|||||.||.....|.||
Mouse   445 VITVFSASNYYEEGSNRGA 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 90/304 (30%)
PP2Ac 54..315 CDD:197547 89/301 (30%)
Ppef1XP_011246120.1 MPP_RdgC 144..479 CDD:277364 94/326 (29%)
PTZ00183 518..660 CDD:185503
EF-hand_7 595..663 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.