DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp3cc

DIOPT Version :10

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001291920.1 Gene:Ppp3cc / 19057 MGIID:107162 Length:522 Species:Mus musculus


Alignment Length:294 Identity:110/294 - (37%)
Similarity:171/294 - (58%) Gaps:23/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DLL-NKLMSFRRSKMQRLPLLESEVNL-LCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLK 96
            ||| |.|:...|        :|.||.| :......:...|..::.|.|||.|.||:||||:||:|
Mouse    40 DLLKNHLVKEGR--------VEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMK 96

  Fly    97 ILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDE 161
            :.:..|.|..|||||||||||||..|:|.:..|.:|::..||.::|||||||.:.:...:.|..|
Mouse    97 LFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQE 161

  Fly   162 CKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDL 226
            |:.:|:..::...:..::|:|:||:::.:..|.|||:||::..|.:|..:.|.:|.|..|.:|||
Mouse   162 CRIKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGPVCDL 226

  Fly   227 LWSDP-DRYGFGWT------SSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ 284
            ||||| :.||...|      ::.||.||.:....:.:|||.|....:.|||:..:.||..:.|.|
Mouse   227 LWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQ 291

  Fly   285 ------LVTVFSAPNYCGLYDNAGASMGVDKDLV 312
                  |:|:||||||..:|:|..|.:..:.:::
Mouse   292 ATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:472684 104/276 (38%)
Ppp3ccNP_001291920.1 MPP_PP2B 37..341 CDD:277361 110/294 (37%)
Catalytic. /evidence=ECO:0000305 52..343 104/274 (38%)
SAPNY motif. /evidence=ECO:0000250|UniProtKB:Q08209 303..307 3/3 (100%)
Calcineurin B binding. /evidence=ECO:0000250|UniProtKB:P16298 344..366
Calmodulin-binding. /evidence=ECO:0000250|UniProtKB:P16298 394..408
Autoinhibitory segment. /evidence=ECO:0000250|UniProtKB:P16298 409..416
Autoinhibitory domain. /evidence=ECO:0000250|UniProtKB:P16298 467..489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 481..522
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.