DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and T25B9.2

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_501992.2 Gene:T25B9.2 / 188880 WormBaseID:WBGene00012008 Length:343 Species:Caenorhabditis elegans


Alignment Length:323 Identity:139/323 - (43%)
Similarity:180/323 - (55%) Gaps:54/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYP--------------- 104
            :|:..||..||||...||:.|.:.|||.|:|||||||.|||.:||..|:|               
 Worm     7 AELAELCHRARELIWSEPIFLKLEAPICVMGDIHGQFDDLLAMLDMNGWPLSSQEFEALKDITVR 71

  Fly   105 -------PQT--------------------------------RYLFLGDYVDRGKNSVETITLLL 130
                   ||:                                ||||||||||||..|:|.:.||.
 Worm    72 SRETGKRPQSEPHSTQPESSNDVKPPVAAPKSVNKEVTTGYKRYLFLGDYVDRGPFSMEVVILLT 136

  Fly   131 ALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCH 195
            ||::.:|..||||||||||:|||..|||:.|...||..:|::.|.:.:|..|..|:|::.|.|.|
 Worm   137 ALKLAYPDRIYLLRGNHESRSVNTSYGFYREVNYRYDAQLYECFQNMFNVFPFCAVINNTIMCMH 201

  Fly   196 GGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQK 260
            ||:|..|...:......||.|:|:.|:|.||.|:|||....|:..|.||.|:::|...|..||:|
 Worm   202 GGISEHLTSFNQFSVFKRPLEIPDVGVLTDLTWADPDPTEKGYKPSARGASFVFGPPALRAFLKK 266

  Fly   261 NDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDIQRGDIR 323
            .|..:|.|.|||||||||||..|:|||:||||||||..||..|...:||.|.||.::.|.:.|
 Worm   267 LDLQMVIRGHQVVEDGYEFFDGRRLVTIFSAPNYCGQNDNTAAVFSIDKKLKISINVFRPESR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 137/315 (43%)
PP2Ac 54..315 CDD:197547 136/313 (43%)
T25B9.2NP_501992.2 PP2Ac 4..328 CDD:197547 138/320 (43%)
MPP_superfamily 7..326 CDD:301300 137/318 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.