DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and T16G12.7

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_499229.1 Gene:T16G12.7 / 188557 WormBaseID:WBGene00011808 Length:319 Species:Caenorhabditis elegans


Alignment Length:300 Identity:135/300 - (45%)
Similarity:195/300 - (65%) Gaps:8/300 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTL--ARELFLDEPMLLNVPAPIRVVGDIHGQFY 92
            ||::|::.|:::. .|.......:.|:..|:..|  |:::|:.:..:|.:.||:::.||:|||:.
 Worm    17 LNVDDIIVKILNI-GSGGNNFEAIMSQKTLVSLLDAAKDVFMKQGAMLELEAPVKICGDVHGQYS 80

  Fly    93 DLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYG 157
            |:|::.|:.|:||...|||||||||||:.|:|...|.||.:||||.:.::||||||..|:|||||
 Worm    81 DVLRLFDRGGFPPLVNYLFLGDYVDRGQQSLEVACLFLAYKVKFPGNFFMLRGNHECGSINRVYG 145

  Fly   158 FFDECKRRYTVK----LWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPT-EV 217
            |.||.:|:|..|    :|..|..|:..||..|::|.||.|.|||:|.::..|:.:.::.||. ||
 Worm   146 FLDEVQRKYGAKGGTTMWNCFQICFAYMPYTALVSGRILCMHGGISKRMNNLNQLRNLQRPVLEV 210

  Fly   218 PETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAK 282
            ....:..|:||||||.....:..|.|||..::|...|...:.|.|.|||.||||||:||||||..
 Worm   211 ANPSVEIDILWSDPDSTVDDFVDSTRGVGQVFGAKALTAIMNKLDVDLVARAHQVVQDGYEFFNN 275

  Fly   283 RQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDIQRGDI 322
            ::|||:||||:|||.:|||.|.|.|||:|..||.|.|..|
 Worm   276 KRLVTIFSAPHYCGEFDNAAAMMNVDKNLTCSFQIMRPSI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 127/272 (47%)
PP2Ac 54..315 CDD:197547 125/267 (47%)
T16G12.7NP_499229.1 MPP_superfamily 18..313 CDD:301300 132/295 (45%)
PP2Ac 40..313 CDD:197547 128/272 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.