DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and F20D6.6

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_505103.2 Gene:F20D6.6 / 184725 WormBaseID:WBGene00017636 Length:316 Species:Caenorhabditis elegans


Alignment Length:297 Identity:68/297 - (22%)
Similarity:136/297 - (45%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYV 116
            |||..:.::...:|..:        :..|:.:.|||..::.|:|.|...||:|.:.:|:|||:.:
 Worm    40 LLEDALEIMDGTSRVEY--------ITPPVNICGDIRSRYGDVLDIFKTCGWPFEQKYVFLGNLI 96

  Fly   117 DRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKT----FVD 176
            |.||.|:||:.:||..::.:|::..:|||.:|.:.|.....|..|.:.|: ....|:.    ...
 Worm    97 DGGKFSLETLVILLCCKICYPQNFVILRGFYEHELVKSDRSFIGELRVRFPDSNKWQALNAIIKS 161

  Fly   177 CYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSD--------PDR 233
            ....:||..:::.::.|.:|.::..:|...|:.|:.............::.:.|        |::
 Worm   162 LLKRLPVMTVLNRKLLCVNGMVTSNIKNEKNVVSVKNGNMFENHNTRVEVQFLDIDIPSPVTPNK 226

  Fly   234 YGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLY 298
            ..             ....::::.|:..|..::..::.||.:||.|..|.||:|:.|.......|
 Worm   227 ID-------------EESKIIKELLKSMDMSMMINSNNVVREGYRFTLKNQLITITSGTKLQKNY 278

  Fly   299 DNAGASMGVDKDLVISF-DIQ------RGDIRRIVVR 328
            :|.|..|.:|:...::| .||      |.|:..:.:|
 Worm   279 NNRGVVMMMDRHNKVNFKSIQGIDGEDRTDLASVPLR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 63/278 (23%)
PP2Ac 54..315 CDD:197547 60/273 (22%)
F20D6.6NP_505103.2 MPP_superfamily 39..285 CDD:387346 60/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.