DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and pph-6

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_497714.2 Gene:pph-6 / 183199 WormBaseID:WBGene00007922 Length:331 Species:Caenorhabditis elegans


Alignment Length:268 Identity:120/268 - (44%)
Similarity:172/268 - (64%) Gaps:9/268 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKMQRLPLLESEVNLLC-TLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTR 108
            |:.:.||  ||:...|| ||...|.| |..::.|.:|:.:.|||||||||||::....|..|.|:
 Worm    40 SECKYLP--ESDAVALCATLIDRLSL-EANVVPVSSPVTICGDIHGQFYDLLELFKTGGTVPNTK 101

  Fly   109 YLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY---TVKL 170
            |:|:|||||||..|:||:|||..|.:|:|..|.||||||||:.::.||||:|||:.:|   .|..
 Worm   102 YVFMGDYVDRGHYSLETVTLLFCLLLKYPNQITLLRGNHESRRISNVYGFYDECQNKYGHGNVHK 166

  Fly   171 WKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYG 235
            |  |...::.:|:.|:|...:.|.||||||.::.:.::..:.|..|||..|.|||::|||||...
 Worm   167 W--FCKVFDVLPIGALIDESVLCVHGGLSPDIRTIDSLMLLDRAQEVPNKGPLCDIMWSDPDDDV 229

  Fly   236 FGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDN 300
            ..|..|.||..:::|..|.|:||..||..|:||:||:|::|:::....:|.||:||||||....|
 Worm   230 EDWVISQRGAGFVFGAKVTEEFLMNNDLSLLCRSHQLVDEGFKYMFNEKLATVWSAPNYCYRCGN 294

  Fly   301 AGASMGVD 308
            |.|...:|
 Worm   295 AAAVFEID 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 118/262 (45%)
PP2Ac 54..315 CDD:197547 117/259 (45%)
pph-6NP_497714.2 MPP_PP2A_PP4_PP6 31..315 CDD:277360 120/268 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.