DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and C27B7.6

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_501547.3 Gene:C27B7.6 / 182956 WormBaseID:WBGene00007763 Length:454 Species:Caenorhabditis elegans


Alignment Length:310 Identity:111/310 - (35%)
Similarity:174/310 - (56%) Gaps:31/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSNSEANADYRLPGALNLNDLLNKLMSFRRSKMQRLPLLE--SEVNLLCTL--ARELFLDEPMLL 75
            |....||.:        :::|..:::    :::::...||  |:.::|..|  .:|:....|.|:
 Worm     2 LETEHANTE--------VHELCRQMI----ARIEKYGTLEGFSDSDILEVLKTIKEILEPLPCLI 54

  Fly    76 NVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHI 140
            .:.||:.|.||||||..|||:..::.|.||..:|||||||||||.||:|....|..:::.|.|.:
 Worm    55 EIIAPVVVFGDIHGQLGDLLQFTNEVGRPPDFQYLFLGDYVDRGPNSLEVTVWLFCMKILFSKKV 119

  Fly   141 YLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKEL 205
            :|||||||.:.||.:|||.:|..|:....|||.|.|.:..:.:.|.|:.:|.|.|||:||:::..
 Worm   120 HLLRGNHEVRRVNTMYGFKEEMMRKRNSHLWKVFNDVFAELSICASINRKILCMHGGISPKIESW 184

  Fly   206 SNIESIARPTEVP--ETGLLCDLLWSDPDRYGFGWTSSD-------RGVSYLYGRDVLEKFLQKN 261
            .::..:.:|....  |.||:.||:||||:|      ..|       ||:|.|:|:.|::......
 Worm   185 DSLTGMTKPRVHGDCEHGLIVDLIWSDPNR------KDDTIQFNKMRGISTLFGKSVVDNLCTTL 243

  Fly   262 DFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDL 311
            ..||:.|||::.|.|:.|....:|:||||||.|.|...|.|:...:.|.|
 Worm   244 AIDLIIRAHEMKEKGHTFEFDNRLLTVFSAPYYSGHNSNLGSVATISKSL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 107/274 (39%)
PP2Ac 54..315 CDD:197547 106/271 (39%)
C27B7.6NP_501547.3 PP2Ac 31..304 CDD:197547 105/269 (39%)
MPP_PPP_family 61..289 CDD:277316 95/233 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.