DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and C34D4.2

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_501125.1 Gene:C34D4.2 / 177489 WormBaseID:WBGene00016398 Length:329 Species:Caenorhabditis elegans


Alignment Length:293 Identity:138/293 - (47%)
Similarity:199/293 - (67%) Gaps:1/293 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLK 96
            |.:|:.:|..:.....|:| ..|.|:..||..|||:|....:.|.:.||:::.||:|||:.|||.
 Worm    25 LQNLVERLKGWTPGHCQKL-FDEKELIQLCYRAREVFWKNNVKLELKAPVKICGDLHGQYEDLLA 88

  Fly    97 ILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDE 161
            :|:..|:||:|:|||||||||||..|:|.|:||.|.:|..|..::||||||||:.||..||||.|
 Worm    89 LLELNGWPPETKYLFLGDYVDRGPFSIEVISLLFAYQVLHPDKVFLLRGNHESRPVNMQYGFFME 153

  Fly   162 CKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDL 226
            |::|::..|:..|...:.|||:.|::|.:|.|.|||:|..|.:|..::.:.||.:||:.|::.||
 Worm   154 CRKRFSNALYDAFQLAFYCMPLCAVVSDKIICMHGGISEDLVDLRQLDKVERPCDVPDIGVIADL 218

  Fly   227 LWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSA 291
            .|:|||.....:..|.||...::|.:.::|||..:..:||.||||||.|||||||.|||||:|||
 Worm   219 TWADPDATIQMYAESQRGAGRVFGAEAVKKFLNTHHLELVVRAHQVVMDGYEFFADRQLVTIFSA 283

  Fly   292 PNYCGLYDNAGASMGVDKDLVISFDIQRGDIRR 324
            |:|||..|||.|.|.||::||.||.:.|.|:::
 Worm   284 PSYCGQMDNAAAVMTVDEELVCSFTVMRPDLKK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 131/265 (49%)
PP2Ac 54..315 CDD:197547 129/260 (50%)
C34D4.2NP_501125.1 MPP_superfamily 25..312 CDD:301300 136/287 (47%)
PP2Ac 46..312 CDD:197547 131/265 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.