DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and pph-4.1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_499603.1 Gene:pph-4.1 / 176657 WormBaseID:WBGene00004085 Length:333 Species:Caenorhabditis elegans


Alignment Length:274 Identity:124/274 - (45%)
Similarity:177/274 - (64%) Gaps:2/274 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KMQRLPLL-ESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRY 109
            |:.|..|: |.:|..||..|||:..:|..:..:.:|:.:.||||||||||:::....|..|.|.|
 Worm    38 KLMRCELIAEQDVKTLCAKAREILAEEGNVQVIDSPVTICGDIHGQFYDLMELFKVGGPVPNTNY 102

  Fly   110 LFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKT 173
            |||||:||||..||||..|||||:.::|..:.|:||||||:.:.:||||:|||.|:| ...:||.
 Worm   103 LFLGDFVDRGFYSVETFLLLLALKARYPDRMMLIRGNHESRQITQVYGFYDECLRKYGNASVWKH 167

  Fly   174 FVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGW 238
            ..:.::.:.:||:|..::||.||||||.:..:..|..|.|..|||..|.:||||||||:....||
 Worm   168 CTEVFDYLSLAAVIDGKVFCVHGGLSPSISTMDQIRVIDRKQEVPHDGPMCDLLWSDPEEGNVGW 232

  Fly   239 TSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGA 303
            ..|.||..||:|.|..:.|.:.|..||:|||||:|.:||::....:::||:||||||....|..|
 Worm   233 GLSPRGAGYLFGADASKTFCETNGVDLICRAHQLVMEGYKWHFNEKVLTVWSAPNYCYRCGNVAA 297

  Fly   304 SMGVDKDLVISFDI 317
            .:.:|::|...|.|
 Worm   298 ILELDENLNKEFTI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 121/267 (45%)
PP2Ac 54..315 CDD:197547 119/261 (46%)
pph-4.1NP_499603.1 PTZ00239 31..333 CDD:173488 124/274 (45%)
MPP_PP2A_PP4_PP6 31..316 CDD:277360 124/274 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.