DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and pef-1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_741091.1 Gene:pef-1 / 175257 WormBaseID:WBGene00003969 Length:707 Species:Caenorhabditis elegans


Alignment Length:320 Identity:103/320 - (32%)
Similarity:159/320 - (49%) Gaps:36/320 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SNSEANADYRLPG---ALNLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNV 77
            :|.:.:.:|:.|.   .|:...:...:.:|:.:|:    |....|.::...||::|...|.:..:
 Worm   183 TNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKV----LHPKYVLMILHEARKIFKAMPSVSRI 243

  Fly    78 PAPI----RVVGDIHGQFYDLLKILDQCGYPP-QTRYLFLGDYVDRGKNSVETITLLLALRVKFP 137
            ...|    .:.||:||:|.||..||.:.|||. ...|:|.||:||||..|:|.:.:|.||.:..|
 Worm   244 STSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDP 308

  Fly   138 KHIYLLRGNHESQSVNRVYGFFDECKRRY---TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLS 199
            ..|||.|||||...:|..|||..|...:|   :..:.:...|.::.:|:|.||...||..|||:|
 Worm   309 MSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGIS 373

  Fly   200 PQ--LKELSNI-----ESIARP--------------TEVPETGLLCDLLWSDPDRYGFGWTSSDR 243
            .|  :.:|..|     :|:.||              ..|.|...:.|::||||.:....|.:..|
 Worm   374 DQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFR 438

  Fly   244 GVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGA 303
            |....:|.|:...||:|:.|.|:.|:|:...:||||......:|||||.||.....|.||
 Worm   439 GGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGA 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 97/282 (34%)
PP2Ac 54..315 CDD:197547 96/279 (34%)
pef-1NP_741091.1 MPP_RdgC 199..515 CDD:277364 100/304 (33%)
PP2Ac 218..514 CDD:197547 97/281 (35%)
EFh 634..699 CDD:238008
EF-hand_7 634..698 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.