DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and F58G1.3

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_496754.2 Gene:F58G1.3 / 174933 WormBaseID:WBGene00010265 Length:364 Species:Caenorhabditis elegans


Alignment Length:260 Identity:124/260 - (47%)
Similarity:175/260 - (67%) Gaps:0/260 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGK 120
            |:..:..:...:|:||..|....|||:|:||||.||.|:.::.|..|..|:.:.:|||||||||.
 Worm    63 EIIAIIRMVEAIFMDESNLCEAEAPIKVIGDIHAQFQDMNRLFDLIGRVPEEKLMFLGDYVDRGP 127

  Fly   121 NSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAA 185
            ..:|.:.||..|::::...|||||||||:.|||::|||:.||:.:|.|.||..|..|:|.||::.
 Worm   128 QGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFYVECQYKYGVGLWWDFQTCFNRMPMSG 192

  Fly   186 IISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYG 250
            :||.|:.|.||||||:|..|..|.:|.||.|..:.|||.|||||||...|.||..|.||:||::|
 Worm   193 LISKRVLCMHGGLSPELINLDTIRNIPRPCEPLDRGLLIDLLWSDPTNKGEGWFHSIRGISYMFG 257

  Fly   251 RDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISF 315
            :.|:|:..:..:.||:.|.||||:||||..|.|:|:||||.||||..:.||.|.:.::.:|.:||
 Worm   258 KGVVEQACKSLEIDLIIRGHQVVQDGYEMMAGRRLITVFSVPNYCAQFTNAAAVVCLNANLQVSF 322

  Fly   316  315
             Worm   323  322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 124/260 (48%)
PP2Ac 54..315 CDD:197547 122/258 (47%)
F58G1.3NP_496754.2 MPP_superfamily 37..327 CDD:301300 124/260 (48%)
PP2Ac 59..329 CDD:197547 124/260 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.