DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and C06A1.3

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:291 Identity:127/291 - (43%)
Similarity:185/291 - (63%) Gaps:13/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KLMSFRRSKMQRLPLLESEVNL-LCT------------LARELFLDEPMLLNVPAPIRVVGDIHG 89
            ||..:....::|:..|..:.|: :|.            :...:|::|..|....|||:|:||||.
 Worm    32 KLAEWMDDCIKRMNSLYKDTNINICNVMTGHEIISIIRMVEAIFMEESNLCEAEAPIKVIGDIHA 96

  Fly    90 QFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNR 154
            |:.|:.::.|..|..|:.:.:|||||||||...:|.:.||..|::::...|||||||||:.|||:
 Worm    97 QYQDMNRLFDLIGRVPEEKLMFLGDYVDRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNK 161

  Fly   155 VYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPE 219
            :|||:.||:.:|.:.||..|..|:|.||::.:||.|:.|.||||||:|..|..|.:|.||.|..:
 Worm   162 IYGFYVECQYKYGIGLWWDFQSCFNRMPMSGLISKRVLCMHGGLSPELINLDTIRNIPRPCEPLD 226

  Fly   220 TGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ 284
            .|||.|||||||...|.||..|.||:||::|:.|:|:..:..:.||:.||||||:||||....|:
 Worm   227 RGLLIDLLWSDPTNKGEGWFHSIRGISYMFGKGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRR 291

  Fly   285 LVTVFSAPNYCGLYDNAGASMGVDKDLVISF 315
            |:||||.||||..:.||.|.:.::.:|.|||
 Worm   292 LITVFSVPNYCAQFTNAAAVVCLNANLQISF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 124/278 (45%)
PP2Ac 54..315 CDD:197547 121/273 (44%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 125/286 (44%)
PP2Ac 59..329 CDD:197547 121/264 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.