DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and F26B1.5

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001040654.1 Gene:F26B1.5 / 172328 WormBaseID:WBGene00017817 Length:383 Species:Caenorhabditis elegans


Alignment Length:307 Identity:111/307 - (36%)
Similarity:172/307 - (56%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQ------------CGYPPQ 106
            :|::.||.....|||..|..|..:..|:.:|||||||:.||::||:.            ..| ..
 Worm    33 KSDLLLLIGQIMELFKMEKTLATISPPVTIVGDIHGQYPDLVRILNSRISKEEAKQKIVTSY-SS 96

  Fly   107 TRYLFLGDYVDRGKNSVETITLLLALRV---------------KFPKHIYLLRGNHESQSVNRVY 156
            .|::|||||||||.:|:|.|.|:.||:|               .:|.:..|||||||::::|..|
 Worm    97 NRFVFLGDYVDRGNHSIECICLVFALKVLDLKFVSLLVIMFQIAYPTNFVLLRGNHETKAINFAY 161

  Fly   157 GFFDECKRRYTVK----LWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEV 217
            ||.:|.:.|...|    :|:.|.:.::.||:|.::..||.|.|||:|.:|:.|.:|:||.||  :
 Worm   162 GFREELENRLGKKDGFEIWEKFNEVFSFMPLACLVGGRILCMHGGISEKLESLDSIDSIVRP--L 224

  Fly   218 PE-TGLLCDLLWSDPDRYGFGWTSSD---------RGVSYLYGRDVLEKFLQKNDFDLVCRAHQV 272
            || |.|..|||||||.......:.||         ||:::.:....:....::.:..||.||||:
 Worm   225 PEVTDLAQDLLWSDPMDVQTLASISDTPKYAKNIVRGLAHSFNDAAVRDVCRRLNLHLVVRAHQM 289

  Fly   273 VEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISFDIQR 319
            :.:|::|.:.|:|:|:||||.|....||.||::.||.:..:|..:.|
 Worm   290 IPEGFKFNSDRKLLTIFSAPRYMNESDNRGATLQVDVNGQLSISVMR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 110/303 (36%)
PP2Ac 54..315 CDD:197547 109/301 (36%)
F26B1.5NP_001040654.1 PP2Ac 31..339 CDD:197547 111/307 (36%)
MPP_PPP_family 61..324 CDD:277316 98/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.