DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and gsp-4

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001379823.1 Gene:gsp-4 / 171960 WormBaseID:WBGene00020187 Length:305 Species:Caenorhabditis elegans


Alignment Length:293 Identity:136/293 - (46%)
Similarity:206/293 - (70%) Gaps:4/293 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPGALNLNDLLNKLMSFRRSKMQRL--PLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIH 88
            :...:::::|:::|::...|. .||  .:.|.|:...|.:|:.:|..:..||.|..||.|.||||
 Worm     1 MTATIDVDNLMSRLLNVGMSG-GRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIH 64

  Fly    89 GQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVN 153
            ||:.|||:|.|:.|:||...:||||||||||:.::|||.|:...::|:|::.::||||||..::|
 Worm    65 GQYSDLLRIFDKNGFPPDINFLFLGDYVDRGRQNIETICLMFCFKIKYPENFFMLRGNHECPAIN 129

  Fly   154 RVYGFFDECKRRY-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEV 217
            |||||::||.||| :.:||..|.|.:|.||:..:|..||.|.||||||.|:.|..:..:.||.:.
 Worm   130 RVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLDQLRQLPRPQDP 194

  Fly   218 PETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAK 282
            |...:..||||:|||::..||.::.|||||::|:||:.....:.|.|||.||||||:|||||||.
 Worm   195 PNPSIGIDLLWADPDQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFAS 259

  Fly   283 RQLVTVFSAPNYCGLYDNAGASMGVDKDLVISF 315
            :::||:||||:|||.:||:.|:|.||:::|.:|
 Worm   260 KKMVTIFSAPHYCGQFDNSAATMKVDENMVCTF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 131/266 (49%)
PP2Ac 54..315 CDD:197547 130/261 (50%)
gsp-4NP_001379823.1 MPP_superfamily 6..297 CDD:417454 136/288 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.