DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp3cc

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_008769035.1 Gene:Ppp3cc / 171378 RGDID:621616 Length:515 Species:Rattus norvegicus


Alignment Length:255 Identity:101/255 - (39%)
Similarity:157/255 - (61%) Gaps:13/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVK 135
            |..:|.|.|||.|.||:||||:||:|:.:..|.|..|||||||||||||..|:|.:..|.:|::.
  Rat    71 EKTMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKIN 135

  Fly   136 FPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSP 200
            .||.::|||||||.:.:...:.|..||:.:|:..:::..:..::|:|:||:::.:..|.|||:||
  Rat   136 HPKTLFLLRGNHECRHLTEYFTFKQECRIKYSELVYEACMHTFDCLPLAALLNQQFLCVHGGMSP 200

  Fly   201 QLKELSNIESIARPTEVPETGLLCDLLWSDP-DRYGFGWT------SSDRGVSYLYGRDVLEKFL 258
            ::..|.:|..:.|..|.|..|.:|||||||| :.||...|      ::.||.||.:....:.:||
  Rat   201 EITCLDDIRKLDRFAEPPAFGPVCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFL 265

  Fly   259 QKNDFDLVCRAHQVVEDGYEFFAKRQ------LVTVFSAPNYCGLYDNAGASMGVDKDLV 312
            |.|....:.|||:..:.||..:.|.|      |:|:||||||..:|:|..|.:..:.:::
  Rat   266 QNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 101/255 (40%)
PP2Ac 54..315 CDD:197547 101/255 (40%)
Ppp3ccXP_008769035.1 MPP_PP2B 37..341 CDD:277361 101/255 (40%)
PP2Ac 54..325 CDD:197547 101/253 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.