DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp6c

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c / 171121 RGDID:708460 Length:305 Species:Rattus norvegicus


Alignment Length:300 Identity:130/300 - (43%)
Similarity:183/300 - (61%) Gaps:10/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQ 100
            |:|.:...| :.:.||  |:::..||....:|.|:|..:..|..|:.|.||||||||||.::...
  Rat     6 LDKYVEIAR-QCKYLP--ENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRT 67

  Fly   101 CGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRR 165
            .|..|.|.|:|:||:||||..|:||.|.||||:.|:|..|.||||||||:.:.:||||:|||:.:
  Rat    68 GGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTK 132

  Fly   166 Y-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWS 229
            | ....|:.....::.:.|||:|..:|.|.||||||.:|.|..|.:|.|..|:|..|..|||:||
  Rat   133 YGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWS 197

  Fly   230 DPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNY 294
            ||:... .|..|.||..:|:|..|..:|:..|:..|:|||||:|.:||:|....:||||:|||||
  Rat   198 DPEDVD-TWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNY 261

  Fly   295 CGLYDNAGASMGVDKDLVISFDIQRGDIRRIVVRNESVSP 334
            |....|. ||:.|.||:    :.:...:.|.|..:|.|.|
  Rat   262 CYRCGNI-ASIMVFKDV----NTREPKLFRAVPDSERVIP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 121/266 (45%)
PP2Ac 54..315 CDD:197547 120/261 (46%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 126/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.