DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppef1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_031752607.1 Gene:ppef1 / 100496625 XenbaseID:XB-GENE-6037564 Length:700 Species:Xenopus tropicalis


Alignment Length:437 Identity:106/437 - (24%)
Similarity:174/437 - (39%) Gaps:145/437 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HSLHFAGQ-------LSNSEAN---ADY------------RLPGALNLNDLLNKLMSFRRSK--- 46
            |..|:.||       :|||:..   .||            |:...|.::|....|.:|::.:   
 Frog    77 HFAHWKGQGPDLISDISNSKEGHKFIDYEKIEVPNSYGGPRITFPLTVSDTNALLRAFKQGQQLH 141

  Fly    47 --------------MQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKI 97
                          :::||.:   |:|..:.::|              |.:.||:||:..|||.|
 Frog   142 ARYVLQLFHETKKFLKQLPNI---VHLSTSYSKE--------------ITICGDLHGKLDDLLLI 189

  Fly    98 LDQCGYP-PQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDE 161
            ..:.|.| .:..|||.||.|||||||:|.:.||....:.:|.::::.|||||...:|..|||.:|
 Frog   190 FYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMNLRYGFTNE 254

  Fly   162 CKRRY---TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGL------------------------- 198
            ..::|   ...:.....|.|:.:|:|.|:..::...|||:                         
 Frog   255 VIQKYKGHARNILLLLEDIYSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRTPK 319

  Fly   199 ---------------------------------------------------SPQLKELSNIES-I 211
                                                               ||.:.|::.::| |
 Frog   320 TDSEKCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGILEINYMDSRI 384

  Fly   212 ARPTEVPET--------GLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCR 268
            ..|.::||.        ..:.|:|||||........:|.||....:|.:|.:|.|.|.:|.::.|
 Frog   385 QLPDKMPELPDSIRKEWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKMLIR 449

  Fly   269 AHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVISF 315
            :|:..::|||.....::||:|||.||.....|.||.:.:..||...|
 Frog   450 SHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRF 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 91/354 (26%)
PP2Ac 54..315 CDD:197547 89/349 (26%)
ppef1XP_031752607.1 MPP_superfamily 121..500 CDD:417454 96/393 (24%)
FRQ1 535..683 CDD:227455
EF-hand_7 616..684 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.