DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp3cb

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_012813808.1 Gene:ppp3cb / 100037840 XenbaseID:XB-GENE-949827 Length:531 Species:Xenopus tropicalis


Alignment Length:301 Identity:119/301 - (39%)
Similarity:175/301 - (58%) Gaps:26/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GALNLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARE---LFLDEPMLLNVPAPIRVVGDIHG 89
            |...|..|.|.|:...|        ||.|..|  .:.||   :...|..:|.|.|||.|.|||||
 Frog    61 GRPQLETLKNHLIKEGR--------LEEEAAL--RIIREGAAILRQEKTMLEVEAPITVCGDIHG 115

  Fly    90 QFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNR 154
            ||:||:|:.:..|.|..|||||||||||||..|:|.:..|.:|::..||.::|||||||.:.:..
 Frog   116 QFFDLMKLFEVGGTPHNTRYLFLGDYVDRGYFSIECVLYLWSLKIIHPKTLFLLRGNHECRHLTE 180

  Fly   155 VYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPE 219
            .:.|..|||.:|:.:::.:.:|.::|:|:||:::.:..|.||||||::..|.:|..:.|..|.|.
 Frog   181 YFTFKQECKIKYSERVYDSCMDAFDCLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPA 245

  Fly   220 TGLLCDLLWSDP-DRYGFGWT------SSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGY 277
            .|.:|||||||| :.||...|      ::.||.||.|....:.:|||.|:...|.|||:..:.||
 Frog   246 FGPMCDLLWSDPAEDYGSEKTLEHFTHNTVRGCSYFYSYPAVCEFLQSNNLLSVIRAHEAQDAGY 310

  Fly   278 EFFAKRQ------LVTVFSAPNYCGLYDNAGASMGVDKDLV 312
            ..:.|.|      |:|:||||||..:|:|..|.:..:.:::
 Frog   311 RMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 113/278 (41%)
PP2Ac 54..315 CDD:197547 112/275 (41%)
ppp3cbXP_012813808.1 MPP_PP2B 63..367 CDD:277361 118/299 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.