DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp1cb

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001004527.2 Gene:ppp1cb / 100003223 ZFINID:ZDB-GENE-030616-609 Length:327 Species:Danio rerio


Alignment Length:291 Identity:174/291 - (59%)
Similarity:231/291 - (79%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GALNLNDLLNKLMSFRRSKMQRL-PLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQF 91
            |.||::.|:::|:..|..:..:: .:.|:||..||..:||:||.:|:||.:.||:::.||||||:
Zfish     4 GELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQY 68

  Fly    92 YDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVY 156
            .|||::.:..|:||:...|||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|
Zfish    69 TDLLRLFEYGGFPPEANNLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 133

  Fly   157 GFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETG 221
            ||:||||||:.:||||||.||:||:|:||||..:||||||||||.|:.:..|..|.|||:||:||
Zfish   134 GFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTG 198

  Fly   222 LLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLV 286
            |||||||||||:...||..:|||||:.:|.||:.|||.::|.||:||||||||||||||||||||
Zfish   199 LLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLV 263

  Fly   287 TVFSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            |:||||||||.:||||..|.||:.|:.||.|
Zfish   264 TLFSAPNYCGEFDNAGGMMSVDESLMCSFQI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 167/265 (63%)
PP2Ac 54..315 CDD:197547 165/260 (63%)
ppp1cbNP_001004527.2 PTZ00480 3..300 CDD:185658 174/291 (60%)
MPP_PP1_PPKL 7..297 CDD:277359 172/288 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.