Sequence 1: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 328 | Identity: | 96/328 - (29%) |
---|---|---|---|
Similarity: | 146/328 - (44%) | Gaps: | 33/328 - (10%) |
- Green bases have known domain annotations that are detailed below.
Human 20 RLLFLV-PTGV--PVRSGDATFPKAMDNVTVRQGESATLRCTIDD-RVTRVAW--LNRSTILYAG 78
Human 79 NDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMNIS 142
Human 143 ---SDITVNEGSSVTLLCLAIGRPEPTVTWR-----HLSV-KEGQGFVSEDEYLEISDIKRDQSG 198
Human 199 EYECSALNDVAAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKEETR 262
Human 263 LATGLDGMR-----IENKGRM-STLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEI----SPS 317
Human 318 SAV 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
OPCML | NP_001306032.1 | Ig | 44..132 | CDD:416386 | 29/91 (32%) |
Ig strand A' | 44..49 | CDD:409353 | 4/4 (100%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 0/4 (0%) | ||
FR2 | 64..70 | CDD:409353 | 3/7 (43%) | ||
Ig strand C | 64..70 | CDD:409353 | 3/7 (43%) | ||
CDR2 | 71..83 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 8/33 (24%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 4/9 (44%) | ||
FR4 | 125..132 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 135..206 | CDD:404760 | 23/79 (29%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 165..170 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
Ig | 224..312 | CDD:416386 | 27/94 (29%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 240..244 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 293..298 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 30/94 (32%) |
Ig | 145..238 | CDD:416386 | 24/92 (26%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 0/7 (0%) | ||
Ig | 242..333 | CDD:416386 | 27/93 (29%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/4 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 3/9 (33%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 4/8 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12195 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 141 | 1.000 | Inparanoid score | I4481 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8497 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.870 |