DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPCML and DIP-delta

DIOPT Version :9

Sequence 1:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:328 Identity:96/328 - (29%)
Similarity:146/328 - (44%) Gaps:33/328 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    20 RLLFLV-PTGV--PVRSGDATFPKAMDNVTVRQGESATLRCTIDD-RVTRVAW--LNRSTILYAG 78
            |::||: .|.:  .|...:..|.:.:.||||..|..|.|.|.::. ...:|||  ::|..||...
  Fly    25 RIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIH 89

Human    79 NDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMNIS 142
            ....|..||..| ..|...:.:.:......|.|.|.|.|.|  :|..|:| :|.|.|||.|::|.
  Fly    90 RHVISRIPRYSI-TYTDNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIE 151

Human   143 ---SDITVNEGSSVTLLCLAIGRPEPTVTWR-----HLSV-KEGQGFVSEDEYLEISDIKRDQSG 198
               |.:.|.|..::.:.|.|.|.|.|.:.||     .::| |:.:..|.:.:.|.::.:.|::.|
  Fly   152 STPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMG 216

Human   199 EYECSALNDVAAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKEETR 262
            .|.|.|.|.|.....:::.:.|.:.|.|..... .|...|....:.|...|.|.|...|......
  Fly   217 AYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVM 281

Human   263 LATGLDGMR-----IENKGRM-STLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEI----SPS 317
            :   |...:     .||..|. ..||..|:...|:|||.|::.|.||.|..||.:|||    :||
  Fly   282 V---LPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343

Human   318 SAV 320
            ..|
  Fly   344 KQV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 29/91 (32%)
Ig strand A' 44..49 CDD:409353 4/4 (100%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 3/7 (43%)
Ig strand C 64..70 CDD:409353 3/7 (43%)
CDR2 71..83 CDD:409353 3/11 (27%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/33 (24%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 4/9 (44%)
FR4 125..132 CDD:409353 3/7 (43%)
Ig_3 135..206 CDD:404760 23/79 (29%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 1/8 (13%)
Ig strand C 165..170 CDD:409353 1/4 (25%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 27/94 (29%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 30/94 (32%)
Ig 145..238 CDD:416386 24/92 (26%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 0/7 (0%)
Ig 242..333 CDD:416386 27/93 (29%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/4 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.