DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and pphB

DIOPT Version :10

Sequence 1:NP_524946.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_417214.1 Gene:pphB / 947196 ECOCYCID:G7415 Length:218 Species:Escherichia coli


Alignment Length:239 Identity:53/239 - (22%)
Similarity:86/239 - (35%) Gaps:76/239 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 ICGDIHGQFYDLMN-IFEINGLPSEKNPYLFN-GDFVDRGSFSVECIFTLFGFKLLYPNHFFLAR 323
            :.|||||::..|.: :.:::..|  |...|.: ||.:|||..|::.:      :||....|...:
E. coli    19 VVGDIHGEYQLLQSRLHQLSFFP--KIDLLISVGDNIDRGPESLDVL------RLLNQPWFTSVK 75

  Fly   324 GNHESINMNQMYGFTGEVTAKYTSAMADIFTQV--------------FNWLPLCHCINQKILVMH 374
            ||||::.:.......|.:   :.::..|.|..:              |:.||  |.|        
E. coli    76 GNHEAMALEAFETGDGNM---WLASGGDWFFDLNDSEQQEAIDLLLKFHHLP--HII-------- 127

  Fly   375 GGLFSTEDVTLDHIR-RIERNCQPPEEGLM------CELLWSDPQQWMGLGQSKRGVGIQFGPDV 432
                   ::|.|:|: .|.....|..|.|.      .||||...:....|....:.:        
E. coli   128 -------EITNDNIKYAIAHADYPGSEYLFGKEIAESELLWPVDRVQKSLNGELQQI-------- 177

  Fly   433 TEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDT 476
                   |..||.|..|.:.|.          |..|:...|.||
E. coli   178 -------NGADYFIFGHMMFDN----------IQTFANQIYIDT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_524946.1 3a0801s09 7..>140 CDD:273380
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 53/239 (22%)
pphBNP_417214.1 PRK09968 1..218 CDD:182173 53/239 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.