DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and CanA-14F

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:303 Identity:120/303 - (39%)
Similarity:166/303 - (54%) Gaps:22/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 LMEHYKAQKRLHRKFAYKILCEIDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEING 280
            |.:|:..:.|:....|.:|:.|..|.:|.:.:::||..|    .|:||||||||||||.:|||.|
  Fly   120 LKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAP----VTVCGDIHGQFYDLMKLFEIGG 180

  Fly   281 LPSEKNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKY 345
            .|: ...|||.||:||||.||:||:..|:..|:.||...||.|||||..::.:.:.|..|...||
  Fly   181 SPA-TTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY 244

  Fly   346 TSAMADIFTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSD 410
            :..:.|.....|:.|||...:||:.|.:|||| |.|...|:.|||::|..:||..|.||:|||||
  Fly   245 SERVYDACMDAFDCLPLAALMNQQFLCVHGGL-SPEIHELEDIRRLDRFKEPPAFGPMCDLLWSD 308

  Fly   411 PQQWMG--------LGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGK---- 463
            |.:..|        ...|.||....:.......|.::|||..|||:||.:|.||.:....:    
  Fly   309 PLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGF 373

  Fly   464 --CITVFSAPNYCDTMGNMGAFITITGNNLKPNYKSFEAVPHP 504
              .||:||||||.|...|..|.:....|.:  |.:.|...|||
  Fly   374 PSLITIFSAPNYLDVYNNKAAVLKYENNVM--NIRQFNCSPHP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 120/303 (40%)
PP2Ac 226..502 CDD:197547 114/289 (39%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 120/303 (40%)
PP2Ac 132..403 CDD:197547 112/276 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.