DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and GLC7

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_011059.3 Gene:GLC7 / 856870 SGDID:S000000935 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:112/260 - (43%)
Similarity:160/260 - (61%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 QPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTLF 309
            ||.|:::..|    ..||||||||:|||:.:||..|.|.|.| |||.||:||||..|:|.|..|.
Yeast    48 QPILLELEAP----IKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLL 107

  Fly   310 GFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVMH 374
            .:|:.||.:||:.|||||..::|::|||..|...:|...:...||..||.||:...|::||..||
Yeast   108 AYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMH 172

  Fly   375 GGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDP-QQWMGLGQSKRGVGIQFGPDVTEKFCK 438
            ||| |.:..:::.|||:.|....|:.||:|:|||||| :..:|..::.|||...|||||..:|.:
Yeast   173 GGL-SPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQ 236

  Fly   439 DNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITI------TGNNLKPNYKS 497
            ..:::.|.|:|:|.:.|||.....:.:|:|||||||....|.||.:::      :...|||..||
Yeast   237 KQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKS 301

  Fly   498  497
            Yeast   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 112/260 (43%)
PP2Ac 226..502 CDD:197547 112/260 (43%)
GLC7NP_011059.3 MPP_PP1_PPKL 7..297 CDD:277359 108/254 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.