DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and SIT4

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_010236.1 Gene:SIT4 / 851513 SGDID:S000002205 Length:311 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:117/307 - (38%)
Similarity:163/307 - (53%) Gaps:22/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 KGPQLEDGKVTLKFMKELMEHYKAQKRLHRKFAYKILCEIDTYMRAQPSLVDITVPDEEKFTICG 263
            :||  ::...|:|..:.|.|:...|           |||:...:..:.|.:.   |.:...|:||
Yeast     4 RGP--DEWLETIKKCQALTENEMKQ-----------LCEMVKELLMEESNIQ---PVQTPVTVCG 52

  Fly   264 DIHGQFYDLMNIFE-INGLPSEKNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHE 327
            ||||||:||:.:|. ..|.|.:.| |:|.||:||||.:|:|....|...|:.||....|.|||||
Yeast    53 DIHGQFHDLLELFRTAGGFPDDIN-YIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHE 116

  Fly   328 SINMNQMYGFTGEVTAKYTSAMA-DIFTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRI 391
            |..:.|:|||..|...||.|... ....|||::|.|...|:.|||.:|||| |.|...||.||.:
Yeast   117 SRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCVHGGL-SPEIRMLDQIRVL 180

  Fly   392 ERNCQPPEEGLMCELLWSDPQQWMGLGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGY 456
            .|..:.|.||...:||||||........|.||.|..||..|..:|...|.|:.|.|:|::...|:
Yeast   181 SRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFGSKVAREFNHVNGLNLIARAHQLVMEGF 245

  Fly   457 EVAHNGK-CITVFSAPNYCDTMGNMGAFITITGNNLKPNYKSFEAVP 502
            :.....| .:||:||||||...||:.:.:.: ..:|:|.:|.|.|||
Yeast   246 KYHFPEKDVVTVWSAPNYCYRCGNVASVMKV-DEDLEPTFKIFSAVP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 117/307 (38%)
PP2Ac 226..502 CDD:197547 108/278 (39%)
SIT4NP_010236.1 MPP_PP2A_PP4_PP6 7..291 CDD:277360 113/300 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.