DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and PP2A-2

DIOPT Version :10

Sequence 1:NP_524946.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_172514.1 Gene:PP2A-2 / 837583 AraportID:AT1G10430 Length:306 Species:Arabidopsis thaliana


Alignment Length:38 Identity:13/38 - (34%)
Similarity:16/38 - (42%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LEVVFWFFVGEMIGRRYI-FGYLVPADYVSKSTKKTVK 121
            |.|:...|..|.:.|... ||.|:|    ||..|...|
plant   278 LSVLITTFTKEKVKRPLEGFGVLIP----SKEQKHGFK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_524946.1 3a0801s09 7..>140 CDD:273380 13/38 (34%)
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809 9/27 (33%)
MPP_PP5_C 198..513 CDD:277362
PP2A-2NP_172514.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.