| Sequence 1: | NP_524946.1 | Gene: | PpD3 / 49779 | FlyBaseID: | FBgn0005777 | Length: | 520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_172514.1 | Gene: | PP2A-2 / 837583 | AraportID: | AT1G10430 | Length: | 306 | Species: | Arabidopsis thaliana |
| Alignment Length: | 38 | Identity: | 13/38 - (34%) |
|---|---|---|---|
| Similarity: | 16/38 - (42%) | Gaps: | 5/38 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 85 LEVVFWFFVGEMIGRRYI-FGYLVPADYVSKSTKKTVK 121 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PpD3 | NP_524946.1 | 3a0801s09 | 7..>140 | CDD:273380 | 13/38 (34%) |
| TPR repeat | 49..77 | CDD:276809 | |||
| TPR repeat | 82..112 | CDD:276809 | 9/27 (33%) | ||
| MPP_PP5_C | 198..513 | CDD:277362 | |||
| PP2A-2 | NP_172514.1 | MPP_PP2A_PP4_PP6 | 6..290 | CDD:277360 | 4/11 (36%) |
| Blue background indicates that the domain is not in the aligned region. | |||||