DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and PPP1CB

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_002700.1 Gene:PPP1CB / 5500 HGNCID:9282 Length:327 Species:Homo sapiens


Alignment Length:260 Identity:111/260 - (42%)
Similarity:157/260 - (60%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 AQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTL 308
            :||.|:::..|    ..||||||||:.||:.:||..|.|.|.| |||.||:||||..|:|.|..|
Human    47 SQPILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLL 106

  Fly   309 FGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVM 373
            ..:|:.||.:|||.|||||..::|::|||..|...::...:...||..||.||:...:::||...
Human   107 LAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCC 171

  Fly   374 HGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDP-QQWMGLGQSKRGVGIQFGPDVTEKFC 437
            |||| |.:..:::.||||.|....|:.||:|:|||||| :...|.|::.|||...||.||..||.
Human   172 HGGL-SPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFL 235

  Fly   438 KDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITI------TGNNLKPNYK 496
            ..::||.|.|:|:|.:.|||.....:.:|:|||||||....|.|..:::      :...|||:.|
Human   236 NRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK 300

  Fly   497  496
            Human   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 111/260 (43%)
PP2Ac 226..502 CDD:197547 111/260 (43%)
PPP1CBNP_002700.1 MPP_PP1_PPKL 7..297 CDD:277359 108/255 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.