DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and PpD6

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster


Alignment Length:349 Identity:124/349 - (35%)
Similarity:186/349 - (53%) Gaps:28/349 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 IAVDKPEKTLSEMY--SDMENITIEDDYKGPQLEDGKVTLK-FMKELM--EHYKAQKRLHRKFAY 232
            :|||    ||..::  ..:.|.....||:.|    |.:.|. .:.:||  ...|.|:....:...
  Fly     1 MAVD----TLHSLHFAGQLSNSEANADYRLP----GALNLNDLLNKLMSFRRSKMQRLPLLESEV 57

  Fly   233 KILCEI--DTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFV 295
            .:||.:  :.:: .:|.|:::..|    ..:.||||||||||:.|.:..|.|.:.. |||.||:|
  Fly    58 NLLCTLARELFL-DEPMLLNVPAP----IRVVGDIHGQFYDLLKILDQCGYPPQTR-YLFLGDYV 116

  Fly   296 DRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWL 360
            |||..|||.|..|...::.:|.|.:|.||||||.::|::|||..|...:||..:...|...:|.:
  Fly   117 DRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCM 181

  Fly   361 PLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQW-MGLGQSKRGV 424
            |:...|:.:|...|||| |.:...|.:|..|.|..:.||.||:|:||||||.:: .|...|.|||
  Fly   182 PVAAIISHRIFCCHGGL-SPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGV 245

  Fly   425 GIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITITGN 489
            ...:|.||.|||.:.|:.|.:.|:|:|.:.|||.....:.:|||||||||....|.||.:.:.  
  Fly   246 SYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVD-- 308

  Fly   490 NLKPNYKSFEAVPHPDVKPMAYAN 513
              |....||: :...|::.:...|
  Fly   309 --KDLVISFD-IQRGDIRRIVVRN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 116/320 (36%)
PP2Ac 226..502 CDD:197547 107/278 (38%)
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 107/277 (39%)
PP2Ac 54..315 CDD:197547 105/271 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.