DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and PpD5

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:244 Identity:103/244 - (42%)
Similarity:149/244 - (61%) Gaps:7/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 AQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTL 308
            :||.|::::.|    ..||||:||||.||:.||:..|:|...| |||.||:||||..|:|.:..|
  Fly    63 SQPMLLELSAP----VKICGDLHGQFKDLLRIFQQCGVPPLSN-YLFLGDYVDRGHCSIETLSLL 122

  Fly   309 FGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVM 373
            ..:||.||..|||.||||||.::|::|||..|...:|:..:...|...::.:|:...|..:|..:
  Fly   123 LTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCV 187

  Fly   374 HGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQSK-RGVGIQFGPDVTEKFC 437
            |||| |.:...||.|||:.|....|.:||:|:||||||.:..|...|. |||...||.::.|.|.
  Fly   188 HGGL-SPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFL 251

  Fly   438 KDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITI 486
            ..:..:.|:|:|:|.:.|||...:.:.:|:||||||||...|.||.:.:
  Fly   252 MQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 103/244 (42%)
PP2Ac 226..502 CDD:197547 103/244 (42%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 103/244 (42%)
MPP_superfamily 25..313 CDD:301300 103/244 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.